Find link

language: af: Afrikaans als: Alemannisch [Alemannic] am: አማርኛ [Amharic] an: aragonés [Aragonese] ar: العربية [Arabic] arz: مصرى [Egyptian Arabic] as: অসমীয়া [Assamese] ast: asturianu [Asturian] az: azərbaycanca [Azerbaijani] azb: تۆرکجه [Southern Azerbaijani] ba: башҡортса [Bashkir] bar: Boarisch [Bavarian] bat-smg: žemaitėška [Samogitian] be: беларуская [Belarusian] be-tarask: беларуская (тарашкевіца) [Belarusian (Taraškievica)] bg: български [Bulgarian] bn: বাংলা [Bengali] bpy: বিষ্ণুপ্রিয়া মণিপুরী [Bishnupriya Manipuri] br: brezhoneg [Breton] bs: bosanski [Bosnian] bug: ᨅᨔ ᨕᨘᨁᨗ [Buginese] ca: català [Catalan] ce: нохчийн [Chechen] ceb: Cebuano ckb: کوردیی ناوەندی [Kurdish (Sorani)] cs: čeština [Czech] cv: Чӑвашла [Chuvash] cy: Cymraeg [Welsh] da: dansk [Danish] de: Deutsch [German] el: Ελληνικά [Greek] en: English eo: Esperanto es: español [Spanish] et: eesti [Estonian] eu: euskara [Basque] fa: فارسی [Persian] fi: suomi [Finnish] fo: føroyskt [Faroese] fr: français [French] fy: Frysk [West Frisian] ga: Gaeilge [Irish] gd: Gàidhlig [Scottish Gaelic] gl: galego [Galician] gu: ગુજરાતી [Gujarati] he: עברית [Hebrew] hi: हिन्दी [Hindi] hr: hrvatski [Croatian] hsb: hornjoserbsce [Upper Sorbian] ht: Kreyòl ayisyen [Haitian] hu: magyar [Hungarian] hy: Հայերեն [Armenian] ia: interlingua [Interlingua] id: Bahasa Indonesia [Indonesian] io: Ido is: íslenska [Icelandic] it: italiano [Italian] ja: 日本語 [Japanese] jv: Basa Jawa [Javanese] ka: ქართული [Georgian] kk: қазақша [Kazakh] kn: ಕನ್ನಡ [Kannada] ko: 한국어 [Korean] ku: Kurdî [Kurdish (Kurmanji)] ky: Кыргызча [Kirghiz] la: Latina [Latin] lb: Lëtzebuergesch [Luxembourgish] li: Limburgs [Limburgish] lmo: lumbaart [Lombard] lt: lietuvių [Lithuanian] lv: latviešu [Latvian] map-bms: Basa Banyumasan [Banyumasan] mg: Malagasy min: Baso Minangkabau [Minangkabau] mk: македонски [Macedonian] ml: മലയാളം [Malayalam] mn: монгол [Mongolian] mr: मराठी [Marathi] mrj: кырык мары [Hill Mari] ms: Bahasa Melayu [Malay] my: မြန်မာဘာသာ [Burmese] mzn: مازِرونی [Mazandarani] nah: Nāhuatl [Nahuatl] nap: Napulitano [Neapolitan] nds: Plattdüütsch [Low Saxon] ne: नेपाली [Nepali] new: नेपाल भाषा [Newar] nl: Nederlands [Dutch] nn: norsk nynorsk [Norwegian (Nynorsk)] no: norsk bokmål [Norwegian (Bokmål)] oc: occitan [Occitan] or: ଓଡ଼ିଆ [Oriya] os: Ирон [Ossetian] pa: ਪੰਜਾਬੀ [Eastern Punjabi] pl: polski [Polish] pms: Piemontèis [Piedmontese] pnb: پنجابی [Western Punjabi] pt: português [Portuguese] qu: Runa Simi [Quechua] ro: română [Romanian] ru: русский [Russian] sa: संस्कृतम् [Sanskrit] sah: саха тыла [Sakha] scn: sicilianu [Sicilian] sco: Scots sh: srpskohrvatski / српскохрватски [Serbo-Croatian] si: සිංහල [Sinhalese] simple: Simple English sk: slovenčina [Slovak] sl: slovenščina [Slovenian] sq: shqip [Albanian] sr: српски / srpski [Serbian] su: Basa Sunda [Sundanese] sv: svenska [Swedish] sw: Kiswahili [Swahili] ta: தமிழ் [Tamil] te: తెలుగు [Telugu] tg: тоҷикӣ [Tajik] th: ไทย [Thai] tl: Tagalog tr: Türkçe [Turkish] tt: татарча/tatarça [Tatar] uk: українська [Ukrainian] ur: اردو [Urdu] uz: oʻzbekcha/ўзбекча [Uzbek] vec: vèneto [Venetian] vi: Tiếng Việt [Vietnamese] vo: Volapük wa: walon [Walloon] war: Winaray [Waray] yi: ייִדיש [Yiddish] yo: Yorùbá [Yoruba] zh: 中文 [Chinese] zh-min-nan: Bân-lâm-gú [Min Nan] zh-yue: 粵語 [Cantonese]

jump to random article

searching for Sequence homology 363 found (563 total)

alternate case: sequence homology

Cystatin (1,073 words) [view diff] exact match in snippet view article find links to article

cystatins are a family of cysteine protease inhibitors which share a sequence homology and a common tertiary structure of an alpha helix lying on top of

in normal cells. The p73 gene encodes a protein with a significant sequence homology and a functional similarity with the tumor suppressor p53. The over-expression

MMP (CMMP), MMP-27 actually shows very little sequence homology with this protease. Sequence homology predicts that the human MMP-27 gene encodes the

additional helix at either or both ends of the basic six. Based on primary sequence homology, they can be partitioned into three structural classes: Minimal ARID

four UCPs—DmUCP4A-C and DmUCP5—have been identified based on their sequence homology with mammalian UCP4 and UCP5. Notably, DmUCP4A has been shown to protect

G protein-coupled receptors (GPCRs) that share 40% to 63% overall sequence homology, including 5-HT1A, 5-HT1B, 5-HT1D, 5-HT1E, and 5-HT1F. Receptors of

(Estrogen Related Receptor Alpha) gene. ERRα was originally cloned by DNA sequence homology to the estrogen receptor alpha (ERα, NR3A1), but subsequent ligand

receptor subtype of ionotropic glutamate receptors. They possess 14–24% sequence homology with AMPA, kainate, and NMDA subunits, but, despite their name, have

siderophores or flavonoids) as well as heme. They share limited regions of sequence homology and a common tertiary structure architecture. This is an eight stranded

selfish genetic elements, represented by labeled circles. Links between circles are color-coded by the gene whose sequence homology establishes the link.

cluster transcripts, notably the first large exon, but no significant sequence homology exists. The function of this cellular adhesion protein is undetermined

and Fgf18 were described and confirmed as being closely related by sequence homology to Fgf8. The three proteins were eventually grouped into the FGF8

kinase belongs to this family although it is not obvious from the sequence homology (it is still structurally related). In enzymology, a deoxynucleoside

polypeptide neurotoxin from the sea anemone Halcurias sp. Based on sequence homology to type 1 and type 2 sea anemone toxins it is thought to delay channel

undiscovered in the "completed" genome. Stemarene synthase demonstrates high sequence homology with stemodene synthase, thus accounting for the latter's discovery

5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. The FOLR2 protein

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins

adenylate cyclase-activating polypeptide (PACAP) and it has an amino acid sequence homology to vasoactive intestinal peptide, secretin, glucagon, and other growth

residues. BRD4 also has an extended C-terminal domain with little sequence homology to other BET family members. The two bromodomains in BRD4, termed

an X protein of unknown function. Different strains of HPgV-2 have sequence homology of 90% or more. Wang, Haiying; Wan, Zhengwei; Xu, Ru; Guan, Yujuan;

Although USP53 is classified as a deubiquitinating enzyme based on sequence homology to other proteases from this group, it lacks a functionally essential

heterotrimeric G proteins. The protein shares extensive amino acid sequence homology with phosducin, a phosphoprotein expressed in the retina and pineal

sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Multiple transcript variants

but is found in abundance in the spleen. The encoded protein has sequence homology to diaphanous and formin proteins within the Formin Homology (FH)1

sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal

threonine dehydratase and human serine dehydratase. Human SDH shows sequence homology of 27% with the yeast enzyme and 27% with the E. coli enzyme. Overall

sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal

sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. [provided by RefSeq, Jul

Chromosome 1 Opening Reading Frame 94 or C1orf94 is a protein in human coded by the C1orf94 gene. The function of this protein is still poorly understood

gene family, SALL4. The SALL genes were identified based on their sequence homology to Spalt, which is a homeotic gene originally cloned in Drosophila

structure of human hormone-sensitive lipase: possible significance of a sequence homology with a lipase of Moraxella TA144, an antarctic bacterium". Proceedings

sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal

DNA Uracil Glycosylase superfamily, each classified based on their sequence homology, and biochemical and structural similarities. Uracil and hypoxanthine

using a combination of the two approaches. Predicting shifts via sequence homology: these are based on the simple observation that similar protein sequences

models and in yeast, both of which have been demonstrated to have high sequence homology with the human kynurenine 3-monooxygenase protein. Studies have shown

cystein-rich domain. It has a molecular mass of 25 kDa. Ablomin shows great sequence homology with triflin (83.7%) and latisemin (61.5%), two other snake venom

maturation inhibitory protein from urine of pregnant women: N-terminal sequence homology with human nonsecretory ribonuclease". Chemical & Pharmaceutical Bulletin

significant sequence homology with other cytokines. Among IL-17 family members, the IL-17F isoforms 1 and 2 (ML-1) have the highest sequence homology with IL-17A

elastase-specific inhibitor (ESI) from bronchial secretions. Evidence of sequence homology and immunological cross-reactivity". Biol. Chem. Hoppe-Seyler. 373

three proteins: p21cip1/waf1, P27kip1, p57kip2 These proteins share sequence homology at the N-terminal domain which allows them to bind to both the cyclin

(Group I, Group II, Group III) based on pharmacological profile, sequence homology, and preferred signal transduction pathway. mGlur7 is a member of

within the human, rat, mouse and chimpanzee genome. There is a 70% sequence homology between mouse and rat and a 45% homology between human and mouse.

Sea anemone toxins act at the receptor site 3. On the basis of its sequence homology, cangitoxin most likely acts on the same receptor site of the previously

feature: it interacts with mammalian Na+ channels. Because of its sequence homology with other β-toxins, BmKAEP is predicted to bind to site 4 (S4) of

expression of a cytosolic megakaryocyte protein-tyrosine-phosphatase with sequence homology to retinaldehyde-binding protein and yeast SEC14p". Proc Natl Acad

MIF4GD, or MIF4G domain-containing protein, is a protein which in humans is encoded by the MIF4GD gene. It is also known as SLIP1, SLBP (Stem-Loop Binding

third possessed a novel protein fold. Some DUF families share remote sequence homology with domains that has characterized function. Computational work can

including bestoxin, birtoxin, ikitoxin and dortoxin. Altitoxin has sequence homology to scorpion β-toxins, suggesting it might target sodium channels.

elegantissima toxin that targets hERG channels. Moreover, APETx1 has 54% sequence homology with BDS1, which is also produced by sea anemones and targets voltage-gated

expression of a cytosolic megakaryocyte protein-tyrosine-phosphatase with sequence homology to cytoskeletal protein 4.1". Proc Natl Acad Sci U S A. 88 (13): 5867–71

transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous

state. Alpha subunits form the actual conductance pore. Based on sequence homology of the hydrophobic transmembrane cores, the alpha subunits of voltage-gated

compared to the FGFs. Although these factors possess remarkably similar sequence homology, they do not bind FGFRs and are involved in intracellular processes

isolation of PTP-RL10, a novel cytoplasmic-type phosphatase with sequence homology to cytoskeletal protein 4.1". Oncogene. 10 (2): 407–14. PMID 7838537

target them. A new class of peptide-derived inhibitors, based on sequence homology with the protein substrate, can be developed. It is challenging to

families. Phosphatases are classified by substrate specificity and sequence homology in catalytic domains. Despite their classification into over one hundred

class. HATs can be grouped into several different families based on sequence homology as well as shared structural features and functional roles. The Gcn5-related

TRPV, TRPM, TRPN, TRPA, TRPP, and TRPML) based on their amino acid sequence homology: the canonical or classic TRPs, the vanilloid receptor TRPs, the melastatin

sweet tasting proteins have different molecular lengths, with no sequence homology and little to none structural homology. Efforts to identify structural

alpha 2 receptor locus, (CHRNA2), within an 8p21 mapped locus, by sequence homology with rat DNA". Somat. Cell Mol. Genet. 21 (2): 147–50. doi:10.1007/BF02255790

is a human gene. The Bardet-Biedl syndrome 10 protein has distant sequence homology to type II chaperonins. As a molecular chaperone, this protein may

consists of multiple collagenous subdomains and exhibits limited sequence homology to alpha 1(XVI)". J. Biol. Chem. 269 (28): 18549–57. doi:10

4238/gmr.15027167. PMID 27420957. Retrieved 28 November 2020. HVSI sequence homology showed that Hazarewal populations fall into three major clusters:

bond in the second "finger" loop. These classes have significant sequence homology and share the same three-dimensional structure, but have differing

mixtures: a method for improved detection of weak but significant protein sequence homology". Comput. Appl. Biosci. 12 (4): 327–45. doi:10.1093/bioinformatics/12

protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties

quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 4 has an evolutionary conserved CpG island and is

masses between 20 and 30 kDa. They display significant amino acid sequence homology. Sixteen cysteine residues, forming 8 disulfide bonds, are strictly

along with low sequence homology (31-72%). However, the C-terminus shows low amino acid variability and high amino acid sequence homology (77-99%).L. acidophilus

exonuclease in humans, was initially called DNase III because it showed sequence homology with dnaQ in E. coli and with eukaryotic DNA polymerase epsilon and

domain is always accompanied by a homeodomain. Despite the lack of sequence homology, 3D structure of POUs is similar to 3D structure of bacteriophage

selfish genetic elements, represented by labeled circles. Links between circles are color-coded by the gene whose sequence homology establishes the link.

in evolutionary time (this track includes 100 species), the less sequence homology remains, but functionally important regions of the genome (e.g., exons

(November 1985). "GTP-binding membrane protein of Escherichia coli with sequence homology to initiation factor 2 and elongation factors Tu and G". Proc. Natl

protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties

localization of D11S1226 to the human EMK1 gene at chromosome band 11q13 by sequence homology search". Cytogenet Cell Genet. 86 (1): 66–7. doi:10.1159/000015413

prostatic acid phosphatase: cDNA cloning, gene mapping and protein sequence homology with lysosomal acid phosphatase". Biochem. Biophys. Res. Commun. 160

Ames Ancestor strains. H9401 has 99.679% sequence homology with Ames Ancestor with an amino acid sequence homology of 99.870%. H9401 has a circular chromosome

groups known beta-lactamase enzymes into four groups according to sequence homology and presumed phylogenetic relationships. Classes A, C and D cleave

metastasis, binds to sulfatide (Gal(3-SO4) beta 1-1Cer) and has a sequence homology with other proteins that bind sulfated glycoconjugates". The Journal

has no available structure, the PAS domain of a protein with high sequence homology to sGC has been crystallized (pdb code 2P04). The PAS domain of sGC

Rodriguez-Marino, S. G. (2004). "Identification of two pseudogenes with sequence homology to human and gorilla MHC class IA genes: Ancestral haplotype in the

with the exception of echinoderms. Gap junction proteins with no sequence homology to connexins were initially identified in fruit flies. It was suggested

forming a ring approximately 95 across and 35 deep. Human SAP has 51% sequence homology with C-reactive protein (CRP), a classical acute phase response plasma

PMID 10986228. Sandegren L, Sjöberg BM (May 2004). "Distribution, sequence homology, and homing of group I introns among T-even-like bacteriophages: evidence

inflammatory cytokines. These three types share a significant degree of sequence homology among themselves (except in the transmembrane and cytoplasmic domains)

Autoantigens and Proteins of Yersinia and Borrelia Share Amino Acid Sequence Homology That Includes Binding Motifs to HLA-DR Molecules and T-Cell Receptor"

Kearsey SE, Ansorge W, Werner D (1994). "A human nuclear protein with sequence homology to a family of early S phase proteins is required for entry into S

HS-1 are both classified as scorpine-like peptides. Based on its sequence homology with other scorpine-like peptides, HS-1 is likely to be a voltage-gated

in membrane ruffles, filopodia, stereocilia and adhesion plaques. Sequence homology and biochemical properties show that fimbrin is highly conserved from

must be present in the same nucleus a second DNA molecule containing sequence homology with the region to be repaired. In a diploid cell in G1 phase of the

size and consist of two halves (N and C terminal), which share much sequence homology. This suggests an evolutionary origin by duplication and fusion of

"Thioredoxin-like domain of human kappa class glutathione transferase reveals sequence homology and structure similarity to the theta class enzyme". Protein Science

Although both isozymes catalyze similar reactions, they share no sequence homology, which is similar to other DGATs reported in various organisms. The

synthesized protein to the Sec61 channel, which shares structural and sequence homology with SecYEG, but is present in the endoplasmic reticulum. Both the

Sifers RN, Kidd VJ, Woo SL (February 1988). "Molecular structure and sequence homology of a gene related to alpha 1-antitrypsin in the human genome". Genomics

PMID 11257305. Ellison J, Hood L (Mar 1982). "Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes"

of CYP1 family enzymes CYP1A1, CYP1A2, CYP1A6 and CYP1B1 based on sequence homology with CYP102". Toxicology. 139 (1–2): 53–79. doi:10.1016/S0300-483X(99)00098-0

protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties

Kawabe T, Yodoi J (Feb 1987). "Human lymphocyte Fc receptor for IgE: sequence homology of its cloned cDNA with animal lectins". Proceedings of the National

functional analogs of U4 and U6, respectively, they share only limited sequence homology (c. 40%). Furthermore, the sequence of U11 in comparison with U1,

candidiasis showing hyphaes Hwp1 of Candida albicans shares similar sequence homology of amino acids with gliadin (α- and γ-gliadins) of gluten protein

In the 1990s, they were defined as a serine proteases due to high sequence homology with alkaline protease, and their inhibition by serine protease inhibitors

be present, in the same nucleus, a second DNA molecule containing sequence homology with the region to be repaired. In a diploid cell in G1 phase of the

PMID 6421489. S2CID 54312675. Ellison J, Hood L (Mar 1982). "Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes"

peptide. HgTX1 is 39 amino acids long and shows an overall amino acid sequence homology of 89% to margatoxin (MgTX). Hongotoxin (HgTX) targets are Shaker-type

shares less than 50% of its sequence homology with all other known peptide toxins. The highest percentage of sequence homology is shared with other tarantula

KRT19a and KRT19b, have been identified, which have significant sequence homology to KRT19 mRNA. Subsequently, attempts to detect the expression of

bonds. Many have regulatory functions. The family was classified by sequence homology into 6 subfamilies in 2006. The human and mouse genomes only contain

Margatoxin is classified as a "scorpion short toxin" by Pfam, showing sequence homology with other potassium channel blockers, such as charybdotoxin (44%)

characterization of Mucor pusillus aspartic proteinase. Amino acid sequence homology with the other aspartic proteinases, disulfide bond arrangement and

is located in the cytoplasmic part of the protein displays limited sequence homology to other proteins, while sequence conservation amongst Popeye proteins

phospholipase C (see below). Phospholipases A2 can be classified based on sequence homology. Increased levels of Lp-PLA2 are associated with cardiac disease,

reports suggest genes encoding lectin-like proteins exhibit close sequence homology. Furthermore, it seems that FLO genes have interchangeable functions

equivalent of SSB in the nucleus of eukaryotic cells, though there is no sequence homology. The mitochondria of eukaryotic cells contain their own single stranded

in proteolytic, thermal, and chemical stability. GTx1-15 displays sequence homology with other ion channel toxins from several spider species. It is homologous

3.1048. PMID 6774012. Ellison J, Hood L (Mar 1982). "Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes"

(progastricsin). Isolation of cDNA clones, localization to chromosome 6, and sequence homology with pepsinogen A". J. Biol. Chem. 264 (1): 375–9. doi:10.1016/S0021-9258(17)31268-1

Kyasanur Forest disease (KFD), with which it shares 89% nucleotide sequence homology. Close similarities indicate that these viruses diverged 700 years

cDNA cloning of a novel factor produced by a human T-cell hybridoma: sequence homology with animal lectins". Mol. Immunol. 29 (4): 537–546. doi:10

PMID 15581580. Chae HZ, Rhee SG (May 1994). "A thiol-specific antioxidant and sequence homology to various proteins of unknown function". BioFactors. 4 (3–4): 177–80

PMID 15581580. Chae HZ, Rhee SG (May 1994). "A thiol-specific antioxidant and sequence homology to various proteins of unknown function". BioFactors. 4 (3–4): 177–80

PTP-like phosphoinositide/-inositol phosphatase PTEN, and significant sequence homology to the PTP domain of a type III-secreted virulence protein from Pseudomonas

signaling. The four PFKFB isoforms share high (85%) ‘2-Kase/2-Pase core’ sequence homology, but have different properties based on variable N- and C- terminal

these GEF families are not structurally related and do not share sequence homology. These GEF domains appear to be evolutionarily unrelated despite similar

approximately 70 and 72 kDa, respectively, and having 65% amino acid sequence homology and near-identical catalytic sites. Both proteins have three domains:

from a common ancestral AST via gene duplication, and they share a sequence homology of approximately 45%. AST has also been found in a number of microorganisms

mixtures: a method for improved detection of weak but significant protein sequence homology", Bioinformatics, 12 (4): 327–345, doi:10.1093/bioinformatics/12.4

"Hematopoietin sub-family classification based on size, gene organization and sequence homology". Current Biology. 3 (9): 573–581. Bibcode:1993CBio....3..573B. doi:10

conserved GABARAP domain. Even though Atg8 does not show a clear sequence homology to ubiquitin, its crystal structure reveals a conserved ubiquitin-like

angle restraints from searching a database for chemical shift and sequence homology". Journal of Biomolecular NMR. 13 (3): 289–302. doi:10.1023/A:1008392405740

dihydroorotate dehydrogenase is dependent on a conserved loop identified by sequence homology, mutagenesis, and limited proteolysis". Biochemistry. 38 (10): 2899–2908

"Penicillopepsin from Penicillium janthinellum crystal structure at 2.8 A and sequence homology with porcine pepsin". Nature. 266 (5598): 140–5. Bibcode:1977Natur

These distinct roles, however, do not significantly differ with the sequence homology between the CDK components. In particular, among these known structures

“Partial primary structure of human pregnancy zone protein: Extensive sequence homology with human a2-macroglobulin (plasma proteins/evolution/acute-phase

"Structural Relationships among Genes That Control Development: Sequence Homology between the Antennapedia, Ultrabithorax, and Fushi Tarazu Loci of

Tschopp J (Jan 1997). "TRAMP, a novel apoptosis-mediating receptor with sequence homology to tumor necrosis factor receptor 1 and Fas(Apo-1/CD95)". Immunity

evolutionarily related to the major family of Ser/Thr PPs and has no sequence homology to ancient PPP enzymes. The current assumption is that PPMs evolved

is a functional homolog of influenza A protein. There is almost no sequence homology between influenza AM2 and BM2 except for the HXXXW sequence motif

HK family. In contrast, the cytoplasmic domain tends to have high sequence homology and contains several well-known motifs. These motifs include the H

receptor to the 5-HT1e is the 5-HT1F receptor. They share 57% amino acid sequence homology and have some pharmacological characteristics in common. Both receptors

and a basic cluster. Its function(s) are unknown. However, due to sequence homology of its protein with SR splicing factors, it is widely believed that

GRK4, GRK5 and GRK6), alone or bound to ligands. Overall, GRKs share sequence homology and domain organization in which the central protein kinase catalytic

Craigen, William J.; Schmitt, Eric S.; Wong, Lee-Jun C. (2010). "Sequence Homology at the Breakpoint and Clinical Phenotype of Mitochondrial DNA Deletion

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2). Sm-like proteins contain

formation of plasma membrane phosphatidylinositol-3-phosphate. Based on sequence homology, mammalian Gapex-5 has been shown to have an amino-terminal Ras GAP

9, and 19 involved in 11q23 abnormalities in acute leukemia share sequence homology and/or common motifs". Proc Natl Acad Sci U S A. 90 (10): 4631–5.

Juno's essential role in the fertility of female mice. Based on a sequence homology search for genes relate to the folate receptor, the gene for folate

demonstrate the ability to predict protein structure in the absence of sequence homology. Using IBM's World Community Grid to carry out folding of whole proteomes

1992). "A major human epididymis-specific cDNA encodes a protein with sequence homology to extracellular proteinase inhibitors". Biol Reprod. 45 (2): 350–7

protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties:

lyssavirus genus can be divided into four phylogroups based upon DNA sequence homology. Phylogroup I includes viruses, such as Rabies virus, Duvenhage virus

Wong-Staal F, Gallo RC, Clements JE, Narayan O, Gilden RV (Jan 1985). "Sequence homology and morphologic similarity of HTLV-III and visna virus, a pathogenic

genetic analysis of beta-toxin of Clostridium perfringens reveals sequence homology with alpha-toxin, gamma-toxin, and leukocidin of Staphylococcus aureus"

interchangeably as CBP/p300. This is a reasonable amalgamation given the sequence homology, structural similarity and binding behaviors of these two proteins

protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins

Escherichia coli major nitroreductase exhibiting a high amino acid sequence homology to Frp, a Vibrio harveyi flavin oxidoreductase". Journal of Bacteriology

complex) isoform gene, and fsTnT is linked with fsTnI genes (Fig. 1). Sequence homology and protein epitope allosteric similarity data suggest that TnT gene

sequence from TsPep3 only in one amino acid and TsPep1 shows 58,6% of sequence homology with Tspep2 and TsPep3. Eight cysteines establish four disulfide bridges

PMID 2349099. Ford MJ, Anton IA, Lane DP (1988). "Nuclear protein with sequence homology to translation initiation factor eIF-4A". Nature. 332 (6166): 736–8

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins

deacetylase superfamily. HDACs, are classified in four classes depending on sequence homology to the yeast original enzymes and domain organization: HDAC (except

single isoform. In non-metazoan species, calcium-release channels with sequence homology to RyRs can be found, but they are shorter than the mammalian ones

active sites. Most enzymes with this capability share a region of sequence homology that includes the motif CxxxCxxC or a close variant. This sequence

be 100 to 500 copies of a fossil element called LOOPER, which has sequence homology to piggyBac, terminates in 5' CCY....GGG 3', and apparently targets

identified by a search of the draft human genome database through its sequence homology to ENTs (equilibrative nucleoside transporters). Common SSRIs have

monomeric cytokine receptor protein. IL-22BP shares approximately 34% sequence homology with the extracellular domain of one subunit of the heterodimeric

catalytic centre of a wide range of RdRps, even those with a low overall sequence homology, are conserved. The catalytic center is formed by several motifs containing

 Genomic analysis of multiple DHFR sequences revealed low overall DNA sequence homology (30%), but surprisingly high conservation in the same regions whose

(FXR) and retinoid X receptor (RXR) proteins, respectively. Based on sequence homology considerations, some researchers reserve the term USP for the EcR

Brown MS, Goldstein JL (Jun 1984). "Domain map of the LDL receptor: sequence homology with the epidermal growth factor precursor". Cell. 37 (2): 577–85

eEF1A possesses two paralogs, eEF1A1 and eEF1A2, with high amino acid sequence homology (approximately 90% identity). The sequences of their promoter regions

strains showed that all capripoxviruses have a very similar nucleotide sequence homology. Strains were also proven to not all be host-specific. All Capripoxviruses

identifying G Protein-Coupled Receptors (GPCR) without using primary sequence homology, which led to the cloning of olfactory receptors in insects. After

protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacological properties

PMID 6421489. S2CID 54312675. Ellison J, Hood L (March 1982). "Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes"

IFN-Omega genes. The human IFNA gene family shares 70-80% amino acid sequence homology, and about 35% identity with IFNB. The high degree of amino-acid sequence

deacetylase superfamily (comprising four classes based on function and DNA sequence homology) that is recruited to enhancers to modulate both the epigenome and

is a β-propeller protein with 7 blade-shaped β-sheets. It shares sequence homology with mammalian proteins involved in regulating chromatin condensation

revealed that the two types of keratins share only about 30% amino acid sequence homology but share similar patterns of secondary structure domains. As suggested

than to the subtype C. By comparison type C has a higher amino acid sequence homology to human MPV. HMPV and AMPV-C share up to 80% of the amino acid identity

protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties

are similar in size, including approximately 110-122 codons, little sequence homology is evident. Coding sequences of its glycoprotein (G) genes were found

called gp45 that is a trimer similar in structure to PCNA but lacks sequence homology to either PCNA or the bacterial beta clamp. The beta clamp is a specific

previously discovered Kv1.3 channel blocker, BmK NSPK showed 79% sequence homology. Furthermore, BmKTX and BmK NSPK also show structural similarities

known human calcium-activated potassium channel grouped according to sequence homology of transmembrane hydrophobic cores: Though not implied in the name

ivanovii is a large repeat protein which shows only limited amino acid sequence homology to ActA from Listeria monocytogenes". FEMS Microbiology Letters. 126

E. coli are -Cys-Ala-Thr-Cys-. Mammalian TrxRs have a much higher sequence homology with glutathione reductase than E. coli. The active-site Cys residues

isoprenoid biosynthetic enzymes, although these enzymes do not share sequence homology. Squalene synthase (SQS) catalyzes the reductive dimerization of farnesyl

AK155, IL-26 was categorized in the IL-10 cytokine family due to sequence homology and secondary structure similarities. The IL-26 expression was initially

OdK2 is further classified as α-KTx 3.11 as it presents significant sequence homology with toxins from the α-KTx 3.x sub-family, especially Bs6, Agitoxin

fact be characterised as a cannabinoid receptor, on the basis of sequence homology at the binding site. Subsequent studies showed that GPR55 does indeed

bearing some similarity to members of the group Circoviridae, it lacks sequence homology with any known viruses. It is classified under the family Anelloviridae

nucleoporin p62 and the essential yeast nuclear pore protein NSP1 show sequence homology and a similar domain organization". Eur. J. Cell Biol. 55 (1): 17–30

and its family as "short-chain scorpion toxins". Spinoxin has 82% sequence homology with maurotoxin (MTX; α-KTx6.2). Most short-chain scorpion toxins

a new ras-related gene (rap2b) isolated from human platelets with sequence homology to rap2". Nucleic Acids Res. 18 (14): 4281. doi:10.1093/nar/18.14

placed randomly; they fell in the center of the region of amino acid sequence homology in strikingly similar locations in 6 of the 10 units and in a symmetric

9, and 19 involved in 11q23 abnormalities in acute leukemia share sequence homology and/or common motifs". Proceedings of the National Academy of Sciences

which consists 10,000 acetyltransferases, named so because of their sequence homology to a class of eukaryotic transcription factors, therein the yeast

precursor, nucleocapsid, and P4 proteins of WMoV exhibited limited sequence homology with the orthologous proteins of other emaraviruses, while proteins

a region of positively charged residues, a short region with low sequence homology, SH3 and SH2 domains, a tyrosine kinase domain, and a short carboxy-terminal

They catalyze 2 successive reactions in the pathway, possess 25% sequence homology, and possess root-mean-square deviations (RMSDs) between 1.5-2 Å,

R (1985). "Structure of the human alpha 1-acid glycoprotein gene: sequence homology with other human acute phase protein genes". Nucleic Acids Res. 13

1016/S0163-4453(05)80037-4. PMID 1602151. Tohdoh N, Tojo S, Agui H, Ojika K (1995). "Sequence homology of rat and human HCNP precursor proteins, bovine phosphatidylethanolamine-binding

a region of positively charged residues, a short region with low sequence homology, SH3 and SH2 domains, a tyrosine kinase domain, and a short carboxy-terminal

acids having been determined earlier that year. The gene has 97% sequence homology with the glycophorin A gene from the 5' UTR approximately 1 kilobase

Knowles, et al. E. coli and Yeast chorismate mutase have a limited sequence homology, but their active sites contain similar residues. The active site

dihydroorotate dehydrogenase is dependent on a conserved loop identified by sequence homology, mutagenesis, and limited proteolysis". Biochemistry. 38 (10): 2899–908

lysyl oxidase and assignment of the gene to chromosome 5 (extensive sequence homology with the murine ras recision gene)". Matrix. 12 (3): 242–8. doi:10

repeats (CCPs) or sushi domains), each having 60 to 70 amino acids. The sequence homology between SCRs ranges between 60 and 99 percent. The transmembrane region

that there is redundancy in the function of this kinase. In fact, sequence homology searches have shown that two other Pim-1-like kinases, Pim-2 and Pim-3

phospholipase D has been identified in mammalian cells: PLD1 and PLD2 (53% sequence homology), each encoded by distinct genes. PLD activity appears to be present

identical to each other; that is, they share gene sequence and amino acid sequence homology. They all also possess conserved amino acids that are important for

been observed through phylogenetic analysis to bear very strong DNA sequence homology to M. thermophila. As its name implies, M. thermophila is a thermophilic

eukaryotic PA26 and PA28 activator proteins, despite the absence of sequence homology between PafE and these proteins. Nevertheless, the length of the PafE

emission spectra overlap minimally, and because they share minimal sequence homology, allowing for the design of selective antibodies that can be used

Y, Shimada M, et al. (1991). "cDNA cloning of human calpastatin: sequence homology among human, pig, and rabbit calpastatins". J. Enzym. Inhib. 3 (1):

March 25, 2024. "BioCentury". BioCentury. Retrieved 2020-12-09. "A Sequence Homology and Bioinformatic Approach Can Predict Candidate Targets for Immune

cells and anti Thy-1.1 with vimentin, and were suggested to be due to sequence homology by studies done more than 20 years back. Thy-1, like many other GPI

"Hematopoietin sub-family classification based on size, gene organization and sequence homology". Current Biology. 3 (9): 573–81. Bibcode:1993CBio....3..573B. doi:10

made up of N terminal domain of around 300–350 amino acids with low sequence homology (13–30% identity), and a more conserved C terminal domain of ~100

ornithine carbamoyltransferase from Pseudomonas aeruginosa. Extensive sequence homology with the anabolic ornithine carbamoyltransferases of Escherichia coli"

over event. The GypA gene itself consists of 7 exons and has 97% sequence homology with GypB and GypE from the 5' untranslated transcription region (UTR)

from cyanobacteria, algae and plants only show approximately 15% sequence homology with the L and M subunits, however the conserved amino acids correspond

peptide at the N-terminal, and four disulfide bonds. It has a high sequence homology (90% identity) with two other toxins from the same Makatoxin protein

enzymes originating by gene duplication and sharing high level (43%) of sequence homology, they differentiate by their kinetics, function and expression pattern

respiratory distress and postpartum hemorrhage. Due to oxytocin's close sequence homology with vasopressin, oxytocin analogs often bind with much lower affinity

relatively conserved among the different subgroups. More important than sequence homology, the 3D structure is very similar among different SAgs resulting in

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins

dipteran Phormia terranovae of two insect antibacterial peptides with sequence homology to rabbit lung macrophage bactericidal peptides". Proceedings of the

involved in DNA replication, directly or indirectly, but have no sequence homology to the Mcm2-7 family. MCM2-7 is required for both DNA replication

 472. Widger WR, Cramer WA, Herrmann RG, Trebst A (February 1984). "Sequence homology and structural similarity between cytochrome b of mitochondrial complex

the C-terminus. These domains consist of 80 to 100 residues with sequence homology between 20% and 60% and fold into β-sheets, which are important for

Marnix H.; Takano, Eriko; Breitling, Rainer (2013-02-14). "Detecting Sequence Homology at the Gene Cluster Level with MultiGeneBlast". Molecular Biology

"Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins". Proceedings of the National Academy of

conserved in Euteleostomi with the exception of Aves. Also, based on sequence homology analysis, distant orthologs of LRRC24 are also conserved in invertebrates

DDE family recombinases, transposases or integrases. Based on core sequence homology, it is believed that RAG1 evolved from a transposase from the Transib

nucleophile (C=cysteine proteases, S=serine proteases). Despite the lack of sequence homology for the PA clan as a whole, individual families within it can be identified

1% homology with each other. These isoforms also share around 30% sequence homology to the human and yeast (Saccharomyces cerevisiae) isoforms. BCAT1

"Structural relationships among genes that control development: sequence homology between the Antennapedia, Ultrabithorax, and fushi tarazu loci of

PMID 24931468. Widger WR, Cramer WA, Herrmann RG, Trebst A (Feb 1984). "Sequence homology and structural similarity between cytochrome b of mitochondrial complex

cloning and characterization of an interferon induced human cDNA with sequence homology to a mammalian peptide chain release factor". The EMBO Journal. 11

acid sequence of SAP-1, an acidic protein of human whole saliva, and sequence homology with human gamma-trace". J. Biochem. 96 (2): 489–98. doi:10.1093/oxfordjournals

Drosophila induces the synthesis of a potent antifungal peptide with sequence homology to plant antifungal peptides". The Journal of Biological Chemistry

It was discovered using a comparative genomics approach that found sequence homology to CpY, a gene found in the sex determining region of the Y chromosome

modeling treats the template in an alignment as a sequence, and only sequence homology is used for prediction. Protein threading treats the template in an

distinct isoforms of PRC1 have been observed. Additionally, PRC1 has sequence homology with Ase1 in yeasts, SPD-1 (spindle defective 1) in C. elegans, Feo

First EA (Jun 1997). "Human tyrosyl-tRNA synthetase shares amino acid sequence homology with a putative cytokine". J Biol Chem. 272 (22): 14420–5. doi:10

sodium-channel type 1 toxins. CgNa shares structural similarities and sequence homology with other anemone type 1 toxins such as ApA, ApB and ATX, and with

Vps26B share a similar bilobal β-sandwich structure and possess 70% sequence homology. However, these two paralogues distinctly differ on the surface patch

been determined (PDB: 5IR6, 5DOQ​). The third subunit does not share sequence homology with the third subunit proteobacteria, but does come into the assemblies

transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous

called MHC class I polypeptide-related sequence A and B. Discovered by sequence homology analysis these proteins are found on the surface of enterocytes of

sequencing can be difficult. Therefore, it may be necessary to utilize a sequence homology search application to work in tandem between a database search and

Shwachman-Bodian-Diamond syndrome. It shares distant structural and sequence homology to a protein named YHR087W found in the yeast Saccharomyces cerevisiae

toxicity. The α-bungarotoxin polypeptide chain shows significant sequence homology with other neurotoxins from cobra and sea snake venoms, particularly

It was also observed that there is significant level of protein sequence homology between the CCL protein and the C-terminal region of ATP citrate lyase

of sodium channels, they belong to distinct families and share no sequence homology. The toxins AFT-II (from Anthopleura fuscoviridis) and ATX-II differ

relatives. The JMTV genome has four segments, two containing genes with sequence homology to non-structural proteins found in flaviviruses, including methyltransferase

Parasutterella and Sutterella contain several similarities, including sequence homology, inability to grow in an aerobic environment, oxidase- and catalase-negative

ATPase SMARCA4 shows similar features, based on the high degree of sequence homology with yeast Snf2. The interface between two subunits, BAF155 (SMARCC1)

annotated and no genetic elements were found that share significant sequence homology with protein toxins, including the absence of mucoricin, an essential

classes from the cytosolic superfamily of GSTs possess more than 40% sequence homology, those from other classes may have less than 25%. Cytosolic GSTs are

inability of bioinformatic tools (BLAST or any other tool to detect sequence homology) to trace back homology when protein sequences are small and evolve

cathepsin E. Predicted sequence, localization to chromosome 1, and sequence homology with other aspartic proteinases". The Journal of Biological Chemistry

non-functional . Such non-functional remnants of genes, with detectable sequence homology, can sometimes still be found in genomes and are called pseudogenes

contains 13 exons, and is approximately 4.5kb in length. CERK shares sequence homology with sphingosine kinase type I, including an N-terminal pleckstrin

protein function based on physical properties of the amino acid and sequence homology. LIST (Local Identity and Shared Taxa) estimates the potential deleteriousness

"Purification and characterization of elastase-specific inhibitor. Sequence homology with mucus proteinase inhibitor". Biological Chemistry Hoppe-Seyler

acids shorter than FALL-39. The cathelicidin family shares primary sequence homology with the cystatin family of cysteine proteinase inhibitors, although

al. The human homolog of the CPT II enzyme shows 82.2% amino acid sequence homology with the rat protein. Significant structural and functional information

INKDCLLPKVVGFCRARFPRYYYNSSSRRCEKFIYGGCGGNANNFSSYYECHIKCFGPR AsKC11 exhibits sequence homology with other venom Kunitz-type peptides from various species, such as

the transmebrane segments of PKD1-like proteins have substantial sequence homology with TRP channels, indicating they may simply have diversified greatly

PAS-B, which are stretches of 200–350 amino acids that exhibit a high sequence homology to the protein domains that were originally found in the Drosophila

significant degree of structural conservation is observed without sequence homology further underpins the significance of these structural solutions to

infect E. coli. In a study it was identified that despite sharing any sequence homology, the E. coli and T4 Dam methylase amino acids sequences share sequence

Golgi apparatus. Mouse, rat and rabbit IL-1ra show 77, 75, and 78% sequence homology to human IL-1ra. L-1ra shows approximately 30% homology to IL-1β at

heterodimers. Estrogen receptor alpha and beta show significant overall sequence homology, and both are composed of five domains designated A/B through F (listed

vol. 91. Kronholm, W. (2010). "The RO(G)-graded Serre spectral sequence". Homology, Homotopy and Applications, 12(1):75-92. Dieck, T. (1987). Transformation

characteristic of the haloacid dehalogenase (HAD) superfamily, as predicted by sequence homology. The HAD superfamily functions on the common theme of an aspartate

angle restraints from searching a database for chemical shift and sequence homology". J. Biomol. NMR. 13 (3): 289–302. doi:10.1023/A:1008392405740. PMID 10212987

G, Murnane JP (June 1999). "Characterization of a human gene with sequence homology to Saccharomyces cerevisiae SIR2". Gene. 234 (1): 161–168. doi:10

reveals discrete functions in RNA degradation, polyadenylation, and sequence homology with exosome proteins". The Plant Cell. 15 (9): 2003–19. doi:10.1105/tpc

production of the "liver isoform." The two promoters have little or no sequence homology and are separated by a 30 kbp sequence which has not yet been shown

and share 21% amino acid identity with each other (the amino acid sequence homology LAT-1 shares with rat, bovine and human latrophilins has been shown

carnitine acetyltransferase (CRAT) and CROT, as these enzymes have 36% sequence homology. A key difference between these enzymes that may explain their selectivities

using phylogenetics, can compare protein amino acid or nucleotide sequence homology (i.e., similarity) to evaluate taxonomy and evolutionary distances

protein in the bacterial membrane. In summary, besides the absence of sequence homology in the actin-binding-region and an alteration in the sequence of ARP2/3

Based on the fact that intrepicalcin and imperacalcin have a 70% sequence homology (see Homology), it is predicted that intrepicalcin has a coiled, spherical

identified in two flying fox species in Australia. It shares 84% sequence homology to other published Hendra virus genomes. This variant has been identified

(1996.) A structural explanation for the twilight zone of protein sequence homology" Structure 4: 1123–27. Fiser A, Gian Do RK, Sali A. (2000) Modeling

shifts predicted from searching a database for torsion angle and sequence homology". J Biomol NMR. 38 (4): 289–302. doi:10.1007/s10858-007-9166-6. PMID 17610132

describing the resulting DNA polymerase processivity increase. Based on sequence homology, DNA polymerases can be further subdivided into seven different families:

different host range, different serological properties, and no nucleotide sequence homology with WMV. WMV also has different cytoplasmic inclusion bodies that

MASCOT software uses an algorithm that looks for significant peptide sequence homology to present the most statistically likely protein in the sample, based

variant forms in some of the major classes. They share amino acid sequence homology and core structural similarity to a specific class of major histones

specific hydrolysis profile. Therefore, there is as little as 20% sequence homology among some of the members of this family. However, recent additions

targets genus-specific proteins, so orthologous proteins which share sequence homology with each other are recognized as substrates by a particular autophagy

As of December 2013, there are 456 alleles identified (mostly by sequence homology) as being A2, of those 27 are nulls, and a large majority have unknown

Gribskov M (1998). "Combining evidence using p-values: application to sequence homology searches". Bioinformatics. 14 (1): 48–54. doi:10.1093/bioinformatics/14

large volume of information tangible, i.e., the use of ChIP and gene sequence. Homology directed repair (HDR) is a technique repairs breaks or lesions in

known as αInt1p. This protein maintains structural similarity and sequence homology to the α-subunits of human leukocyte integrins. The αInt1p protein

protease inhibitor (SdPI-2). The mature protein of this toxin has 96.6% sequence homology with a toxin named LmKTT-1b (SdPI). The mature protein is established

insecticidal proteins (Vip; InterPro: IPR022180). Vip proteins do not share sequence homology with Cry proteins, in general do not compete for the same receptors

groups later cloned GAB2 by searching DNA database for protein with sequence homology to GAB1. GAB2 is a large multi-site docking protein (LMD) of about

Waldinger D, Eckerskorn C, Lottspeich F, Cleve H (1988). "Amino-acid sequence homology of a polymorphic cellular protein from human lymphocytes and the chaperonins

composition. Richardson and coworkers designed a 79-residue protein with no sequence homology to a known protein. In the 1990s, the advent of powerful computers

amino acids and features five disulphide bridges. It exhibits 61-73% sequence homology with other long neurotoxins. Distinctive characteristics of pseudonajatoxin

chain acyl-coenzyme A, and isovaleryl-coenzyme A dehydrogenases. Sequence homology of four enzymes of the acyl-CoA dehydrogenase family". The Journal

downstream signalling pathways. This molecule, termed Hp-TGM, shares no sequence homology to TGF-β and is secreted by H. polygyrus in a biologically active

(1996.) A structural explanation for the twilight zone of protein sequence homology. Structure 4: 1123–27. Yousif, Ragheed Hussam, et al. "Exploring the

them to travel systemically. Additionally, due to the high degree of sequence homology between Wnts many are characterized by their downstream actions. Wnt5a

regarding the function of Siglec-8 on basophils. Due to its high level of sequence homology with CD33 (Siglec-3), Siglec-8 is grouped within the CD33-related

which they have been tested. HSPs are divided into families, based on sequence homology and molecular weight (hsp110, hsp100, hsp90, hsp70, hsp60, hsp40,

analysis of the Sta58 major antigen gene of Rickettsia tsutsugamushi: sequence homology and antigenic comparison of Sta58 to the 60-kilodalton family of stress

motility). Some of the proteins participating in T3SS share amino-acid sequence homology to flagellar proteins. Some of the bacteria possessing a T3SS have

comprise proteins from the innexin family. Innexins have no significant sequence homology with connexins. Though differing in sequence to connexins, innexins

was identified. Other potential family members were identified by sequence homology. Chen et al. (2010) reviewed evidence for a new class of sugar transporters

are both G-protein-coupled receptors that share an 85% amino acid sequence homology. Both receptors are involved in modulating synaptic functions including

lyssavirus genus can be divided into four phylogroups based upon DNA sequence homology. Phylogroup I includes viruses, such as Rabies virus, Duvenhage virus

and bioinformatics resources have been developed for refinement of sequence homology-based assignments of protein functions: InParanoid: Identifies eukaryotic

in the human, is conserved across vertebrate species and has low sequence homology to spectrin, a cytoskeletal protein involved in forming the actin

in the human, is conserved across vertebrate species and has low sequence homology to spectrin, a cytoskeletal protein involved in forming the actin

have been used interchangeably in scientific literature. 16S RNA sequence homology has confirmed the relatedness between these species but core genome

information from structural homology and must rely on information from sequence homology and modeling physical interactions within the protein. Rosetta@home

mitochondrial genome of the specimen collected from Blaine, WA shared 99.5% sequence homology to the specimen characterized from South Korea," "How officials in

and is bound to the thylakoid membrane facing the stroma. Based on sequence homology, the enzyme is predicted to contain four alpha helix domains that

crystallography. Conservation of the residues in ACS's catalytic domain and sequence homology suggest that ACS catalyzes the synthesis of ACC in a similar fashion

horizontal transfer through a viral vector. SINEs are known to share sequence homology with LINES which gives a basis by which the LINE machinery can reverse

IE110 (n/a) HHV-2 Herpes simplex virus-2 (HSV-2) has 61.5% amino acid sequence homology to HSV-1 ICP0. HHV-3 Varicella zoster virus (VZV) ORF-61 Shows homology

name stems from the fact that its RasGAP-related domain (GRD) has sequence homology to the Sar1 GTPase. It was hypothesized that IQGAP1 would act as a

Rooij and colleagues performed a database search for proteins with sequence homology to both GEFs for Ras and Rap1 and to cAMP-binding sites, which led

Schubert, M.; Lazzarini, R. A.; Rosenberg, M. (1 July 1978). "Nucleotide sequence homology at the 3' termini of RNA from vesicular stomatitis virus and its defective

etiologic agent for this condition. Within these two viruses is a sequence homology of 95%. In 2012, HHV-6A and HHV-6B were officially recognized as distinct

disadvantages of StEP include that it is time consuming and requires sequence homology. SCOPE (protein engineering) Glick BR (2017). Molecular biotechnology :

protein is a molecular chaperone. This creates an issue with the sequence homology that has been seen between 70 kilodalton heat shock proteins in eukaryotes

Co atoms are replaced with Zn, which hinders enzymatic activity. Sequence homology between human and Pfprol yield only 25% identity and 43% similarity

benzoate substructures, respectively. Five genes, KedN1–N5, bear high sequence homology with the enzymes responsible for naphthonate synthesis in

predominant species, and at 786 amino acids is the longest one. Amino acid sequence homology of this isoform of human CASS4 with other family members is 26% overall

It is a close bacterial homolog of P-glycoprotein (Pgp) by protein sequence homology and has overlapping substrate specificities with the MDR-ABC transporter

within the LDL receptor family. In particular, there is 50% overall sequence homology between VLDLR and ApoER2, another lipoprotein receptor of this family

sunitinib, trifluridine, and aminolevulinic acid. GT198 has protein sequence homology with DNA topoisomerase, so that DNA topoisomerase inhibitors are also

variant surface glycoprotein. However, it has little similarity (low sequence homology) with the VSG gene (<25%). SRA is an expression site associated gene

PMID 17889653. Hejgaard J, Rasmussen SK, Brandt A, SvendsenI (1985). "Sequence homology between barley endosperm protein Z and protease inhibitors of the

found in brain tissues. α-SNAP and β-SNAP share approximately 83% sequence homology and are encoded by NAPA and NAPB on chromosomes 19 and 18, respectively

peanut Gly-1 cDNA clone, revealing its glycinin protein with high sequence homology to other legumes, conserved domains, and specific expression during

interaction patterns. Although reticulons do not share any primary sequence homology with DP1/Yop1p proteins, both families have a conserved domain of

with K+ ions passing through the channel The discovery of strong sequence homology between KcsA and other channels in the Kv family, including the Shaker

the shell proteins have not been found to have any structural or sequence homology to capsid proteins. Instead, structural and sequence comparisons suggest

whether an amino acid substitution affects protein function. SIFT uses sequence homology to predict whether an amino acid substitution will affect protein

characteristics with ubiquitin, despite the fact that they only have 8-15% sequence homology. Both fold into a similarly shaped globular structure with an exposed

birds evolved separately from those of mammals and share very little sequence homology with the XY chromosomes. As such, scientists refer to bird sex chromosomes

into evolutionary biology. Both chicken and turkeys have identical sequence homology (amino acid for amino acid), as do pigs, cows and sheep. Both humans

is a small polypeptide toxin from the α-KTX subfamily. It shares sequence homology with other potassium channel blockers from the same subfamily, such

therapeutic strategy involves administering miR-128, an agent with 90% sequence homology, or an agent capable of increasing the expression or activity of miR-128

and the precursor peptide is termed BstA. BstA shares high sequence homology with BtmD in the follower peptide region. Unlike other ribosomal peptide

assigned to any functional category on the basis of the amino acid sequence homology. Thus, these αr35 members are putative cis-encoded antisense sRNAs

acids. A set of organisms from all domains of life was chosen and the sequence homology of the sulfatase motif was determined. The sequence used is the best

New Guinea. Immunological analysis highlights that MbRV shares 93% sequence homology with GaLV-SEATO which is significantly higher than McERV and MDEV

amino acid substitution is likely to affect protein function based on sequence homology and the physic-chemical similarity between the alternate amino acids

experimentally, it can also lead to missed genes of interest due to differing sequence homology in genes of related function. Gibson assembly is a quick cloning method

in the phosphorylation of PER. However its gene sequence shows no sequence homology. In addition, casein kinase 1 epsilon does not completely rescue circadian