Find link

language:

Find link is a tool written by Edward Betts.

searching for Post-translational modification 177 found (650 total)

alternate case: post-translational modification

Nucleosome (6,666 words) [view diff] no match in snippet view article find links to article

A nucleosome is the basic structural unit of DNA packaging in eukaryotes. The structure of a nucleosome consists of a segment of DNA wound around eight

Isotope-coded affinity tag (404 words) [view diff] no match in snippet view article find links to article

only cysteine containing peptides are analysed, often the post translational modification is lost. The original tags were developed using deuterium,

KIAA0895 (993 words) [view diff] no match in snippet view article find links to article

KIAA0895 is a protein that in Homo sapiens is encoded by the KIAA0895 gene. The gene encodes a protein commonly known as the KIAA0895 protein. Its aliases

Env (gene) (2,253 words) [view diff] no match in snippet view article

Env is a viral gene that encodes the protein forming the viral envelope. The expression of the env gene enables retroviruses to target and attach to specific

C8orf58 (609 words) [view diff] no match in snippet view article find links to article

bioinformatic tools on Expasy were used to determine potential post translational modification sites for the C8orf58 protein. There are two predicted phosphorylation

Phosphopeptide (275 words) [view diff] exact match in snippet view article find links to article

Protein phosphorylation is a very important and frequent post-translational modification that can impact a protein's localization, stability, and whether

CCDC11 (243 words) [view diff] no match in snippet view article find links to article

Coiled-Coil Domain Containing 11, also known as CCDC11 is a protein, that is encoded by CCDC11 gene located at chromosome 18 in humans. The CCDC11 gene

Juvenile hormone epoxide hydrolase (671 words) [view diff] no match in snippet view article find links to article

Juvenile hormone epoxide hydrolase (JHEH) is an enzyme that inactivates insect juvenile hormones. This inactivation is accomplished through hydrolysis

NHLRC2 (643 words) [view diff] no match in snippet view article find links to article

NHL Repeat Containing Protein 2, or NHLRC2, is a protein encoded by the NHLRC2 gene . NHLRC2 has also been referred to as Novel NHL Repeat Domain Containing

Coiled-coil domain containing protein 120 (665 words) [view diff] case mismatch in snippet view article find links to article

26 March 2021. Retrieved 10 May 2013. "ExPasy Proteomics: Post-Translational Modification". ExPasy. Retrieved 11 May 2013. "Q96HB5 (CC120_HUMAN)". Uniprot

TMEM241 (855 words) [view diff] no match in snippet view article find links to article

TMEM241 Isoform 1 Post translational modification sites

C16orf96 (563 words) [view diff] no match in snippet view article find links to article

C16orf96, or chromosome 16 open reading frame 96, is a protein in humans that is encoded by C16orf96 that is found on the 16th chromosome. In Homo sapiens

UPF0488 (1,165 words) [view diff] no match in snippet view article find links to article

UPF0488 is a protein that in humans is encoded by the C8orf33 (Chromosome 8 Open Reading Frame 33) gene. Chromosome 8 open reading frame 33 (C8orf33) is

C2CD4D (409 words) [view diff] no match in snippet view article find links to article

acid sequence of C2CD4D can be accessed at [1] Prior to any post translational modification, C2CD4D has a molecular weight of 37.6 kdal. Although scientists

ITIH2 (1,035 words) [view diff] no match in snippet view article find links to article

contain a Gla domain, and thus be dependent for production on post translational modification requiring vitamin K. Its function is also presumably dependent

Transmembrane protein 44 (413 words) [view diff] no match in snippet view article find links to article

Transmembrane protein 44 is a protein that in humans is encoded by the TMEM44 gene. mRNA sequence of the TMEM44 gene is 1483 base pairs long, with 13 exons

CXorf36 (1,100 words) [view diff] no match in snippet view article find links to article

Chromosome X open reading frame 36 (CXorf36) is a gene that in humans encodes a protein “hypothetical protein LOC79742”. This protein has a function that

DGLUCY (1,057 words) [view diff] no match in snippet view article find links to article

DGLUCY (D-glutamate cyclase) is a protein that in humans is encoded by the DGLUCY gene. The human gene, DGLUCY, is highly conserved in mammals and birds

Microviridin (399 words) [view diff] exact match in snippet view article find links to article

Philmus B, Christiansen G, Yoshida WY, Hemscheidt TK (2008). "Post-translational modification in microviridin biosynthesis". ChemBioChem. 9 (18): 3066–73

Cathepsin E (2,278 words) [view diff] no match in snippet view article find links to article

Cathepsin E is an enzyme (EC 3.4.23.34) that in humans is encoded by the CTSE gene. The enzyme is also known as slow-moving proteinase, erythrocyte membrane

FAM167A (1,196 words) [view diff] no match in snippet view article find links to article

Family with sequence similarity 167, member A is a protein in humans that is encoded by the FAM167A gene located on chromosome 8. FAM167A and its paralogs

ZC3H12B (1,010 words) [view diff] no match in snippet view article find links to article

ZC3H12B, also known as CXorf32 or MCPIP2, is a protein encoded by gene ZC3H12B located on chromosome Xq12 in humans. The ZC3H12B gene is composed of 19

CCDC47 (1,148 words) [view diff] no match in snippet view article find links to article

Coiled-coil domain 47 (CCDC47) is a gene located on human chromosome 17, specifically locus 17q23.3 which encodes for the protein PAT complex subunit CCDC47

Morn repeat containing 1 (1,434 words) [view diff] no match in snippet view article find links to article

MORN1 containing repeat 1, also known as Morn1, is a protein that in humans is encoded by the MORN1 gene. The function of Morn1 is not yet well understood

C20orf96 (814 words) [view diff] no match in snippet view article find links to article

C20orf96 (Chromosome 20 open reading frame 96) is a protein-coding gene in humans. It codes for an unknown protein known as uncharacterized protein C20orf96

TMEM44 (807 words) [view diff] no match in snippet view article find links to article

TMEM44 (Transmembrane protein 44) is a protein that in humans is encoded by the TMEM44 gene. DKFZp686O18124 is a synonym of TMEM44. TMEM44 gene has 14

ZIC5 (544 words) [view diff] exact match in snippet view article find links to article

species. ZIC5 has recently been found to be regulated by the post-translational modification SUMOylation in order to alter the DNA and protein binding properties

FAM110A (772 words) [view diff] no match in snippet view article find links to article

Protein FAM110A, also known as protein family with sequence similarity 110, A, C20orf55 or BA371L19.3 is encoded by the FAM110A gene. FAM110A is located

PRR32 (1,044 words) [view diff] no match in snippet view article find links to article

PRR32 is a protein that in humans is encoded by the CXorf64 (Chromosome X open reading frame 64) gene. It was also found that the homologs of the PRR32

ANKRD24 (992 words) [view diff] no match in snippet view article find links to article

Ankyrin repeat domain-containing protein 24 is a protein in humans that is coded for by the ANKRD24 gene. The gene is also known as KIAA1981. The protein's

Greenlee Lough (456 words) [view diff] exact match in snippet view article find links to article

chromophore consisting of an imidazolone ring, formed by a post-translational modification of the tripeptide -Ser65-Tyr66-Gly67-. It is likely that crayfish

C15orf54 (1,149 words) [view diff] no match in snippet view article find links to article

found in this protein. One motif with a high probability of post translational modification sumoylation sites were found. Sumoylation sites are involved

C11orf86 (1,161 words) [view diff] no match in snippet view article find links to article

Chromosome 11 open reading frame 86, also known as C11orf86, is a protein-coding gene in humans. It encodes for a protein known as uncharacterized protein

CobB (1,885 words) [view diff] no match in snippet view article find links to article

CobB is a bacterial protein that belongs to the sirtuin family, a broadly conserved family of NAD+-dependent protein deacetylases. CobB is a bacterial

Subgenomic mRNA (437 words) [view diff] exact match in snippet view article find links to article

Fang, S; Keng, CT; Tan, YJ; Liu, DX (Aug 2007). "Expression, post-translational modification and biochemical characterization of proteins encoded by subgenomic

Werner syndrome helicase (4,150 words) [view diff] no match in snippet view article find links to article

Werner syndrome ATP-dependent helicase, also known as DNA helicase, RecQ-like type 3, is an enzyme that in humans is encoded by the WRN gene. WRN is a

Coiled-coil domain containing 74a (1,231 words) [view diff] no match in snippet view article find links to article

Coiled-coil domain containing 74A is a protein that in humans is encoded by the CCDC74A gene. The protein is most highly expressed in the testis and may

Homocysteine thiolactone (234 words) [view diff] exact match in snippet view article find links to article

isopeptide bonds with lysine residues in substrate proteins, a post-translational modification known as N-homocysteinylation (N-hcy). This causes protein

FAM43A (1,640 words) [view diff] no match in snippet view article find links to article

The family with sequence similarity 43 member A (FAM43A) gene, also known as; GCO3P195887, GC03P194406, GC03P191784, and NM_153690.3, codes for a 423 bp

C17orf78 (983 words) [view diff] no match in snippet view article find links to article

Uncharacterized protein C17orf78 is a protein encoded by the C17orf78 gene in humans. The name denotes the location of the parent gene, being at the 78th

PCSK6 (2,148 words) [view diff] exact match in snippet view article find links to article

a calcium-dependent serine endoprotease that catalyzes the post-translational modification of precursor proteins from its ‘latent’ form to the cleaved

C12orf60 (1,805 words) [view diff] no match in snippet view article find links to article

Uncharacterized protein C12orf60 is a protein that in humans (Homo sapiens) is encoded by the C12orf60 gene. The gene is also known as LOC144608 or MGC47869

FAM155B (1,333 words) [view diff] no match in snippet view article find links to article

Family with Sequence Similarity 155 Member B is a protein in humans that is encoded by the FAM155B gene. It belongs to a family of proteins whose function

Ccdc60 (1,286 words) [view diff] no match in snippet view article find links to article

Coiled-coil domain containing 60 is a protein that in humans is encoded by the CCDC60 gene that is most highly expressed in the trachea, salivary glands

Elongation factor P (1,319 words) [view diff] exact match in snippet view article find links to article

Aoki H, Huang BX, Kim HY, Ganoza MC, Park MH (January 2012). "Post-translational modification by β-lysylation is required for activity of Escherichia coli

Neuromedin B (575 words) [view diff] exact match in snippet view article find links to article

TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2). The (NH2) here indicates a post-translational modification -- alpha amidation of the carboxy terminus. Neuromedin regulates

C16orf90 (1,345 words) [view diff] exact match in snippet view article find links to article

and apoptosis based on expression data from microarrays and post-translational modification data. C16orf90 or Chromosome 16 open reading frame 90 has no

C6orf136 (1,366 words) [view diff] no match in snippet view article find links to article

C6orf136 (Chromosome 6 Open Reading Frame 136) is a protein in humans (Homo sapiens) encoded by the C6orf136 gene. The gene is conserved in mammals, mollusks

AtSCE1 (1,718 words) [view diff] exact match in snippet view article find links to article

that is a member of the small ubiquitin-like modifier (SUMO) post-translational modification pathway. This process, and the SCE1 enzyme with it, is highly

EMBiology (226 words) [view diff] exact match in snippet view article find links to article

relationship with AGK State Change Changes in a protein's post-translational modification status or alternative splicing events Breast cancer has a "StateChange"

C10orf95 (1,054 words) [view diff] no match in snippet view article find links to article

Chromosome 10 open reading frame 95 is a protein that in humans is encoded by the c10orf95 gene. The protein is involved in pre-mRNA splicing and is localized

Histone H3 (623 words) [view diff] exact match in snippet view article find links to article

protrudes from the globular nucleosome core and is susceptible to post-translational modification that influence cellular processes. These modifications include

N-Myc (1,978 words) [view diff] exact match in snippet view article find links to article

binding of MYCN to C-terminal domains of tetrameric p53. As a post-translational modification, MYCN binding to C-terminal domains of tetrameric p53 impacts

VXN (806 words) [view diff] case mismatch in snippet view article find links to article

Portal - Home". expasy.org. Retrieved 2016-04-25. "Overview of Post-Translational Modification". Thermo Fisher Scientific. Retrieved 2016-05-09. "ISH Data ::

Adipose triglyceride lipase (1,825 words) [view diff] exact match in snippet view article find links to article

through two different pathways: transcriptionally and through post-translational modification. Through the transcriptional pathway, Beta-adrenergic, a receptor

Crotonyl-CoA (299 words) [view diff] exact match in snippet view article find links to article

CCR homolog came from the bacterium Rhodobacter sphaeroides. Post-translational modification of histones either by acetylation or crotonylation is important

George B. Johnson (1,312 words) [view diff] exact match in snippet view article find links to article

Genetics (J. Scandalios, Ed.), Academic Press, N.Y.: 239-273 Post-translational modification as a potential explanation of high levels of enzyme polymorphism

C5orf49 (660 words) [view diff] exact match in snippet view article find links to article

analysis: Molecular Weight: 17 kDa Isoelectric point: 7.0 Post-translational modification: fourteen post-translational modifications are predicted: Seven

Cartilage associated protein (829 words) [view diff] exact match in snippet view article find links to article

a tight protein complex with two other enzymes involved in post-translational modification: Leprecan (P3H1) and PPIB. In this complex, CRTAP acts as a

Andrea Ballabio (1,174 words) [view diff] exact match in snippet view article find links to article

sulphatase family (17 in humans) are deficient due to a defect in a post-translational modification. Using an innovative approach, he identified the SUMF1 (Modification

Maltase-glucoamylase (1,284 words) [view diff] exact match in snippet view article find links to article

S2CID 560536. Danielsen EM (October 1987). "Tyrosine sulfation, a post-translational modification of microvillar enzymes in the small intestinal enterocyte"

Histatin 1 (706 words) [view diff] exact match in snippet view article find links to article

(2007). "Tyrosine polysulfation of human salivary histatin 1. A post-translational modification specific of the submandibular gland". J. Proteome Res. 6 (7):

6-phosphogluconolactonase (1,507 words) [view diff] exact match in snippet view article find links to article

PMID 9918669. Kim KM, Yi EC, Baker D, Zhang KY (May 2001). "Post-translational modification of the N-terminal His tag interferes with the crystallization

CD6 (1,219 words) [view diff] exact match in snippet view article find links to article

JW, Romain PL, Hull SR, Rudd CE (1991). "Biosynthesis and post-translational modification of CD6, a T cell signal-transducing molecule". J. Biol. Chem

C7orf50 (3,640 words) [view diff] no match in snippet view article find links to article

C7orf50 (Chromosome 7, Open Reading Frame 50) is a gene in humans (Homo sapiens) that encodes a protein known as C7orf50 (uncharacterized protein C7orf50)

Bone morphogenetic protein 1 (1,428 words) [view diff] exact match in snippet view article find links to article

PMID 11986329. Garrigue-Antar L, Hartigan N, Kadler KE (2003). "Post-translational modification of bone morphogenetic protein-1 is required for secretion and

Histone H4 (1,585 words) [view diff] exact match in snippet view article find links to article

protein-protein interaction) or C-terminal tail (involved in post-translational modification). The Osteogenic Growth Peptide (OGP) is a 14-aa peptide produced

Endothelin A receptor (1,183 words) [view diff] exact match in snippet view article find links to article

Differential modulation of signal transduction activity by post-translational modification". The Journal of Biological Chemistry. 271 (34): 20811–9. doi:10

Holoprotein (405 words) [view diff] exact match in snippet view article find links to article

Cronan JE (1999). "The enzymatic biotinylation of proteins: a post-translational modification of exceptional specificity". Trends Biochem. Sci. 24 (9): 359–63

Adaptive response (1,187 words) [view diff] exact match in snippet view article find links to article

Badrinarayanan, Anjana (2023-10-10), Widespread prevalence of a post-translational modification in activation of an essential bacterial DNA damage response

Annexin A6 (1,264 words) [view diff] exact match in snippet view article find links to article

SM, Davies AA, Crumpton MJ (Nov 1992). "A growth-dependent post-translational modification of annexin VI". Biochimica et Biophysica Acta (BBA) - Protein

PCOLCE2 (543 words) [view diff] exact match in snippet view article find links to article

collagen-binding protein differing in distribution of expression and post-translational modification from the previously described PCPE1". J. Biol. Chem. 277 (51):

PPIB (2,598 words) [view diff] exact match in snippet view article find links to article

folding. Thus, PPIB is essential for collagen biosynthesis and post-translational modification and affects fibril assembly, matrix cross-linking, and bone

14-3-3 protein (1,358 words) [view diff] exact match in snippet view article find links to article

TP, Schulz A, Taipalensuu J, Palmgren MG (February 2002). "Post-translational modification of plant plasma membrane H(+)-ATPase as a requirement for functional

D-Amino acid (1,589 words) [view diff] exact match in snippet view article find links to article

GA, Baliban RC, Floudas CA (September 2011). "Proteome-wide post-translational modification statistics: frequency analysis and curation of the swiss-prot

Elizabeth Nolan (1,143 words) [view diff] exact match in snippet view article find links to article

Christopher T. (2007). "Biosynthetic tailoring of microcin E492m: post-translational modification affords an antibacterial siderophore-peptide conjugate". Journal

Phalloidin (1,696 words) [view diff] exact match in snippet view article find links to article

biosynthetic genes are clustered near the MSDIN genes. The first post-translational modification of the 34-mer is proteolytic cleavage via a prolyl oligopeptidase

Arginine kinase (728 words) [view diff] exact match in snippet view article find links to article

proteolytic degradation. Arginine phosphorylation is a dynamic post-translational modification, which can also be reversed by pArg-specific phosphatases,

Periplasm (2,287 words) [view diff] exact match in snippet view article find links to article

pathogenicity are secretion proteins, which are often subject to post-translational modification including disulfide bond formation. The oxidative environment

Lung microbiota (1,687 words) [view diff] exact match in snippet view article find links to article

explanation of commensal tolerance of the epithelium refers to the post-translational modification of a protein by the covalent attachment of one or more ubiquitin

PPP1R10 (711 words) [view diff] exact match in snippet view article find links to article

targeting subunit is a hypoxia inducible gene: its role in post-translational modification of p53 and MDM2". Cell Death Differ. 14 (6): 1106–16. doi:10

Proline isomerization in epigenetics (2,254 words) [view diff] case mismatch in snippet view article find links to article

Comprehensive View of the Epigenetic Landscape. Part II: Histone Post-translational Modification, Nucleosome Level, and Chromatin Regulation by ncRNAs". Neurotoxicity

KIAA0090 (1,126 words) [view diff] no match in snippet view article find links to article

outside the cell, the cytosol, the nucleus, or mitochondria. Post translational modification of KIAA0090 can occur. 54 possible sites of phosphorylation

Isopenicillin N N-acyltransferase (361 words) [view diff] exact match in snippet view article find links to article

Roach PL, Robinson CV, Schofield CJ. "Investigations into the post-translational modification and mechanism of isopenicillin N:acyl-CoA acyltransferase using

Movement protein (1,048 words) [view diff] exact match in snippet view article find links to article

which can inactivate the viral MPs and provide an avenue for post-translational modification and regulation of viral movement. Phosphorylation also can

Amine oxidase (copper-containing) (1,159 words) [view diff] exact match in snippet view article

bound redox cofactor, topaquinone (TPQ). TPQ is formed by post-translational modification of a conserved tyrosine residue. The copper ion is coordinated

Hyaluronan synthase (2,531 words) [view diff] exact match in snippet view article find links to article

M.I.; Deen, A.J. (July 2019). "Effects of mutations in the post-translational modification sites on the trafficking of hyaluronan synthase 2 (HAS2)".

Deoxycytidine kinase (2,519 words) [view diff] exact match in snippet view article find links to article

regulate both catalytic activity and substrate specificity is a post-translational modification on Serine 74, a residue in the insert region on each of the

Native chemical ligation (1,384 words) [view diff] exact match in snippet view article find links to article

impossible to make, due to their large size, decoration by post-translational modification, and containing non-coded amino acid or other chemical building

CLEC3B (843 words) [view diff] exact match in snippet view article find links to article

M, et al. (2000). "Mass spectrometric characterisation of post-translational modification and genetic variation in human tetranectin". Biol. Chem. 380

Pikachurin (1,298 words) [view diff] exact match in snippet view article find links to article

mutations in POMGnT1 or LARGE. These two genes mediated a post-translational modification on O-mannose, which is essential for pikachurin binding to

Biology of the Cell (459 words) [view diff] case mismatch in snippet view article find links to article

(2011), Endoplasmic Reticulum (2012), Epigenetics (2012), Post-Translational Modification and Virus Intracellular Trafficking (2012), Optogenetics (2014)

Feline cutaneous asthenia (922 words) [view diff] exact match in snippet view article find links to article

site. Procollagen peptidase is an enzyme necessary for the post-translational modification of procollagen into collagen. Because of the abnormalities

Benedikt Kessler (2,167 words) [view diff] exact match in snippet view article find links to article

M. J., Kramer, H. B., Altun, M., & Kessler, B. M. (2010). Post-translational modification of the deubiquitinating enzyme otubain 1 modulates active RhoA

Rhabdoviridae (2,697 words) [view diff] exact match in snippet view article find links to article

starting codes. Phosphoproteins (P) and glycoprotein (G) undergo post-translational modification. Trimers of P protein are formed after phosphorylation by kinase

Cafeteria roenbergensis virus (1,414 words) [view diff] exact match in snippet view article find links to article

encodes proteins that can carry out ubiquitination, which is a post-translational modification of proteins that functions in cellular signaling. Viral reproduction

Src family kinase (1,215 words) [view diff] exact match in snippet view article find links to article

catalytic domain into an inactive state. Myristoylation is a post-translational modification marked by the covalent attachment of a myristoyl group to an

G protein-coupled receptor kinase (2,053 words) [view diff] exact match in snippet view article find links to article

phosphorylation by protein kinase A or protein kinase C, and by post-translational modification of cysteines by S-nitrosylation. X-ray crystal structures have

FAM63B (1,235 words) [view diff] exact match in snippet view article find links to article

7%. The presence of both NLS and NES signals and O-GlcNAc post-translational modification of FAM63B supports the protein's location in both the nucleus

TMEM128 (2,036 words) [view diff] exact match in snippet view article find links to article

phosphorylation, SUMOylation, and O-GlcNAc as seen below: Post-translational modification alters protein structure and can thus alter protein function

PCOLCE (843 words) [view diff] exact match in snippet view article find links to article

collagen-binding protein differing in distribution of expression and post-translational modification from the previously described PCPE1". J. Biol. Chem. 277 (51):

Cholera toxin (3,334 words) [view diff] exact match in snippet view article find links to article

heterotrimeric G proteins, using NAD⁺ as a substrate. This post-translational modification inhibits GTP hydrolysis, locking Gsα in its active GTP-bound

TEAD2 (2,030 words) [view diff] exact match in snippet view article find links to article

on a conserved cysteine at the C-term of the protein. This post-translational modification is critical for proper folding of TEAD proteins and their stability

Zoi Lygerou (608 words) [view diff] no match in snippet view article find links to article

Patras Medical School. Lygerou's research primarily focuses on post translational modification, otherwise known as RNA processing in humans. However, Lygerou

TMEM106A (1,043 words) [view diff] exact match in snippet view article find links to article

include transmembrane structures). There are several areas for post-translational modification for TMEM106A including: Phosphorylation, N-glycosylation Lysine

Abgent (850 words) [view diff] exact match in snippet view article find links to article

is a tool used to predict sumoylation sites, an important post-translational modification of proteins. SUMO-modified proteins contain the tetrapeptide

TMEM106A (1,043 words) [view diff] exact match in snippet view article find links to article

include transmembrane structures). There are several areas for post-translational modification for TMEM106A including: Phosphorylation, N-glycosylation Lysine

Abgent (850 words) [view diff] exact match in snippet view article find links to article

is a tool used to predict sumoylation sites, an important post-translational modification of proteins. SUMO-modified proteins contain the tetrapeptide

Lumír Krejčí (1,021 words) [view diff] exact match in snippet view article find links to article

traits.” His main contributions concerns: (i) the effect of post-translational modification of diverse HR proteins by Sumo protein (examples include: Rad52

Proximity ligation assay (1,101 words) [view diff] exact match in snippet view article find links to article

situ proximity ligation analyses of protein interactions and post-translational modification of the epidermal growth factor receptor family". Cytometry

UTP—glucose-1-phosphate uridylyltransferase (2,932 words) [view diff] exact match in snippet view article find links to article

(2003-07-03). "O-GlcNAc turns twenty: functional implications for post-translational modification of nuclear and cytosolic proteins with a sugar". FEBS Letters

Pulmonary surfactant (2,662 words) [view diff] exact match in snippet view article find links to article

the secretory pathway in type II cells. They undergo much post-translational modification, ending up in the lamellar bodies. These are concentric rings

Plantazolicin (837 words) [view diff] exact match in snippet view article find links to article

ribosomally-synthesized precursor peptide undergoes extensive post-translational modification, including cyclodehydrations and dehydrogenations, catalyzed

C11orf16 (710 words) [view diff] no match in snippet view article find links to article

Post translational modification of protein C11orf16

Northwestern blot (1,435 words) [view diff] no match in snippet view article find links to article

blot (DNA-protein interaction detection), the eastern blot (post translational modification detection) and the northwestern blot (RNA-protein interaction

Messenger RNP (1,048 words) [view diff] exact match in snippet view article find links to article

fluid and generated through liquid-liquid phase separation. Post-translational modification (PTM) of granule components have the means to modulate binding

Carbamate (3,969 words) [view diff] exact match in snippet view article find links to article

can bind with neutral amine groups to form a carbamate, this post-translational modification is known as carbamylation. This modification is known to occur

TMEM125 (896 words) [view diff] exact match in snippet view article find links to article

criticality in lung cancer networks. This is consistent with post-translational modification analysis; TMEM125 phosphorylation suggests it may be involved

Biotin carboxyl carrier protein (1,387 words) [view diff] exact match in snippet view article find links to article

Dardel et al., 1993), which similarly undergo an analogous post-translational modification. These domains form a flattened β-barrel structure comprising

Uncombable hair syndrome (2,429 words) [view diff] exact match in snippet view article find links to article

hair shaft. PADI3 and TGM3 are two enzymes responsible for post-translational modification of TCHH important for cross-linking of TCHH within the hair

FOXO4 (2,764 words) [view diff] exact match in snippet view article find links to article

of the human FOXO3a-DBD/DNA complex suggests the effects of post-translational modification". Nucleic Acids Research. 35 (20): 6984–6994. doi:10.1093/nar/gkm703

Leguminous lectin family (526 words) [view diff] exact match in snippet view article find links to article

Auffret A, Hanke DE (1985). "Polypeptide ligation occurs during post-translational modification of concanavalin A.". Nature. 313 (5997): 64–7. Bibcode:1985Natur

Concanavalin A (2,270 words) [view diff] exact match in snippet view article find links to article

Auffret A, Hanke DE (1985). "Polypeptide ligation occurs during post-translational modification of concanavalin A". Nature. 313 (5997): 64–67. Bibcode:1985Natur

Organic anion transporter 1 (2,503 words) [view diff] exact match in snippet view article find links to article

of drugs, fluids, or meals as well as metabolic activity. Post-translational modification is a process where new functional group(s) are conjugated to

Cis-natural antisense transcript (1,615 words) [view diff] exact match in snippet view article find links to article

stranded RNA. Epigenetic modifications like DNA methylation and post-translational modification of core histones form the basis of the second model. Although

Formylglycine-generating enzyme (1,211 words) [view diff] exact match in snippet view article find links to article

enzymes: radical SAM enzymes able to catalyze in vitro sulfatase post-translational modification". Journal of the American Chemical Society. 129 (12): 3462–3

TMEM106C (828 words) [view diff] exact match in snippet view article find links to article

valine-rich with no tryptophan. There are several areas for post-translational modification for TMEM106A including: Phosphorylation Kinase-Specific Phosphoylation

Neurofibroma (3,257 words) [view diff] no match in snippet view article find links to article

Farnesyltransferase inhibitor which inhibits the Ras kinase in a post translational modification step before the kinase pathway becomes hyperactive. It successfully

RALB (1,603 words) [view diff] exact match in snippet view article find links to article

C-terminal hypervariable region, which contains multiple sites for post-translational modification, leading to diverging subcellular localization and biological

Simon Boulton (1,928 words) [view diff] exact match in snippet view article find links to article

for DNA repair, and that poly (ADP-ribosyl)ation (PAR) is a post-translational modification of proteins that play an important role in mediating protein

C14orf119 (2,146 words) [view diff] exact match in snippet view article find links to article

N-glycosylation sites at positions 25-27 and 48–50. This type of post-translational modification plays important roles in both the structure and function of

SH3BGRL3 (951 words) [view diff] exact match in snippet view article find links to article

colonies formed by 76%. Xu et al. reported SH3BGRPL3 protein as a post-translational modification of the 27kDa tumor necrosis factor alpha (TNF-α) inhibitory

Rho gtpase activating protein 21 (710 words) [view diff] exact match in snippet view article find links to article

Martins-de-Souza D, Traina F, Novello JC, Saad ST, Archangelo LF (2012). "Post-translational modification of the RhoGTPase activating protein 21, ARHGAP21, by SUMO2/3"

Catecholamines up (759 words) [view diff] exact match in snippet view article find links to article

protein is composed of seven transmembrane helices that induce post-translational modification of both enzymes TH and GTPCH, and two conserved extracellular

Surfactant protein D (1,686 words) [view diff] exact match in snippet view article find links to article

interact with DMBT1, and hemagglutinin of influenza A virus. Post-translational modification of SP-D i.e. S-nitrosylation switches its function. Pulmonary

Exitron (1,317 words) [view diff] exact match in snippet view article find links to article

affected protein domains, disordered regions, and various post-translational modification sites that impact protein function. Spliced exitrons can result

Anne Dejean-Assémat (1,479 words) [view diff] exact match in snippet view article find links to article

cellular defect. She then showed that arsenic induces the post-translational modification of PML-RARa by the small SUMO protein as well as the degradation

Korean Society for Biochemistry and Molecular Biology (427 words) [view diff] exact match in snippet view article find links to article

oxide modulates apoptosis and inflammation by redox-based post-translational modification". Koreanstudies Information Service System. 한국학술정보(주). Retrieved

Transthyretin (2,408 words) [view diff] exact match in snippet view article find links to article

contain a Gla domain, and thus be dependent for production on post-translational modification requiring vitamin K, but the potential link between vitamin

FAM131A (929 words) [view diff] exact match in snippet view article find links to article

localized to the nucleoli rim within the cell. Five different post-translational modification sites have been predicted for the FAM131A protein. These include

Bacteriocin (3,542 words) [view diff] exact match in snippet view article find links to article

et al. (February 2011). "Cysteine S-glycosylation, a new post-translational modification found in glycopeptide bacteriocins". FEBS Letters. 585 (4):

Cortactin (2,576 words) [view diff] exact match in snippet view article find links to article

11q13 amplification is associated with both overexpression and post-translational modification". J. Biol. Chem. 272 (11): 7374–80. doi:10.1074/jbc.272.11

HNRPH3 (920 words) [view diff] exact match in snippet view article find links to article

PMID 11004512. Yagüe J, Vázquez J, López de Castro JA (2001). "A post-translational modification of nuclear proteins, N(G),N(G)-dimethyl-Arg, found in a natural

Beta-1 adrenergic receptor (3,469 words) [view diff] exact match in snippet view article find links to article

G-proteins. The extracellular loops also contain several sites for post-translational modification and are involved in ligand binding. The third intracellular

Steroidogenic factor 1 (3,478 words) [view diff] exact match in snippet view article find links to article

placenta. Transcription capacity of SF-1 can be influenced by post-translational modification. Specifically, phosphorylation of serine 203 is mediated by

MAGEA11 (1,774 words) [view diff] exact match in snippet view article find links to article

enables direct MAGE-A11 binding to the androgen receptor. Post-translational modification of the protein by phosphorylation of Thr-360 and monoubiquitinylation

Heterologous expression (5,772 words) [view diff] exact match in snippet view article find links to article

from gene-by-gene studies to a whole-organism approach to post-translational modification. Oocytes are readily optimized for their large size and translational

TMEM269 (1,315 words) [view diff] no match in snippet view article find links to article

on sites surpassing a 0.5 NetPhos threshold on a YinOYang post translational modification prediction algorithm These sites are located at amino acid

Protein aggregation (2,885 words) [view diff] exact match in snippet view article find links to article

Puertas S, Carretero M, Rodriguez V, Liñares R, et al. (eds.). Post-translational modification of cellular proteins by ubiquitin and ubiquitin-like molecules:

Donghun Award (371 words) [view diff] exact match in snippet view article find links to article

oxide modulates apoptosis and inflammation by redox-based post-translational modification". Koreanstudies Information Service System. 한국학술정보(주). Retrieved

Cytochrome c oxidase (3,590 words) [view diff] exact match in snippet view article find links to article

Crystallographic studies of cytochrome c oxidase show an unusual post-translational modification, linking C6 of Tyr(244) and the ε-N of His(240) (bovine enzyme

C16orf95 (946 words) [view diff] exact match in snippet view article find links to article

structure. The tools available at ExPASy were used to predict post-translational modification sites on C16orf95. The following modifications are predicted:

RALA (2,012 words) [view diff] exact match in snippet view article find links to article

C-terminal hypervariable region, which contains multiple sites for post-translational modification, leading to diverging subcellular localization and biological

Branched-chain amino acid aminotransferase (3,560 words) [view diff] exact match in snippet view article find links to article

to oxidizing agents and modulated through S-nitrosation, a post-translational modification that regulates cell signaling. Modification of these two cysteine

C12orf66 (1,320 words) [view diff] exact match in snippet view article find links to article

Visual representation of the protein encoded by the human C12orf66 gene with predicted secondary structures and post-translational modification sites

TEAD1 (4,085 words) [view diff] exact match in snippet view article find links to article

on a conserved cysteine at the C-term of the protein. This post-translational modification is critical for proper folding of TEAD proteins and their stability

Tissue transglutaminase (3,860 words) [view diff] exact match in snippet view article find links to article

(July 2018). "TG2 regulates the heat-shock response by the post-translational modification of HSF1". EMBO Reports. 19 (7): e45067. doi:10.15252/embr.201745067

C1orf27 (1,201 words) [view diff] case mismatch in snippet view article find links to article

1007/s12154-009-0032-8. PMC 2816741. PMID 19898886. "Proteomics/Post-translational Modification/Glycosylation - Wikibooks, open books for an open world". en

TEAD1 (4,085 words) [view diff] exact match in snippet view article find links to article

on a conserved cysteine at the C-term of the protein. This post-translational modification is critical for proper folding of TEAD proteins and their stability

Sexual selection in fungi (1,494 words) [view diff] exact match in snippet view article find links to article

assess mate quality. Pheromones are costly to produce due to post-translational modification and therefore may be subject to the handicap principle in which

Jeremy Gunawardena (1,482 words) [view diff] exact match in snippet view article find links to article

processing in eukaryotic cells, with a focus on mechanisms like post-translational modification, gene regulation and allostery. Gunawardena has had a long-standing

CCDC78 (739 words) [view diff] exact match in snippet view article find links to article

to show ubiquitous expression at moderate levels. Predicted post-translational modification: Phosphorylation of several serine residues has been predicted

FAM210B (853 words) [view diff] exact match in snippet view article find links to article

reaffirmed by multiple methods. They are highlighted in the post-translational modification image below. The following conceptual translation presents

MID1 (2,218 words) [view diff] exact match in snippet view article find links to article

ligase in vitro and in cells. Ubiquitination is a type of post-translational modification in which the transfer of one or several ubiquitin peptide molecules

Nickel superoxide dismutase (1,436 words) [view diff] exact match in snippet view article find links to article

sodF, stopping the production of iron superoxide dismutase. Post-translational modification is also required to produce the active enzyme. In order to

BCAR1 (2,861 words) [view diff] exact match in snippet view article find links to article

repeats within the substrate domain and represent the major post-translational modification of p130Cas/BCAR1. p130Cas/BCAR1 tyrosine phosphorylation can

Α-Bungarotoxin (5,102 words) [view diff] exact match in snippet view article find links to article

ribosomes, leading to the synthesis of the prepropeptide. Lastly, post-translational modification and folding occur. The mature peptide is stored in the venom

Quantitative proteomics (3,409 words) [view diff] exact match in snippet view article find links to article

are more sensitive to difference in protein structure like post-translational modification and thus can quantify differing modifications to proteins.

Embryonal fyn-associated substrate (4,850 words) [view diff] exact match in snippet view article find links to article

and therapeutic response. The changes in EFS expression and post-translational modification in the context of disease discussed below are summarized in

TMEM248 (1,088 words) [view diff] no match in snippet view article find links to article

Figure 3. TMEM248 domain and post translational modification diagram. P represents phosphorylation sites, Ub represents ubiquitylation sites, and G represents

CCDC121 (1,166 words) [view diff] exact match in snippet view article find links to article

L264 to E305 and N363 to E397. CCDC121 is predicted to have post-translational modification sites for: acetylation, Protein Kinase C and Casein Kinase

Collagen (7,444 words) [view diff] exact match in snippet view article find links to article

the Golgi apparatus, the procollagen goes through one last post-translational modification, adding oligosaccharides (not monosaccharides as in step 3)

Microphthalmia-associated transcription factor (4,822 words) [view diff] exact match in snippet view article find links to article

Erlich T, Wang J, Kim BG, Han JM, et al. (August 2017). "Post-translational modification of HINT1 mediates activation of MITF transcriptional activity

Hybrizyme (2,045 words) [view diff] exact match in snippet view article find links to article

They include gene conversion, transposable element activity, post-translational modification, mutations. and intragenic recombination. Some of these hypotheses

Guillardia (3,097 words) [view diff] no match in snippet view article find links to article

endomembrane system, transcription, RNA processing and translation, post translational modification, protein turnover, and cytoskeletal genes. The Guillardia nuclear

Cofactor transferase family (670 words) [view diff] exact match in snippet view article find links to article

(September 1999). "The enzymatic biotinylation of proteins: a post-translational modification of exceptional specificity". Trends Biochem. Sci. 24 (9): 359–63

SERTM2 (1,065 words) [view diff] exact match in snippet view article find links to article

human proteins. The human SERTM2 protein has one confirmed post-translational modification at the 11th position. The asparagine at that position undergoes